PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.005G166300.1
Common NamePHAVU_005G166300g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB_related
Protein Properties Length: 356aa    MW: 38644.5 Da    PI: 8.9933
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.005G166300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.53e-13111155347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE+ l++ + ++lG+g+W+ Iar +   Rt+ q+ s+ qky
  Phvul.005G166300.1 111 AWTEEEHRLFLIGLQKLGKGDWRGIARNFVVSRTPTQVASHAQKY 155
                         7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.887104160IPR017930Myb domain
SuperFamilySSF466891.42E-16106160IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-18107159IPR006447Myb domain, plants
SMARTSM007176.4E-10108158IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-11109154IPR009057Homeodomain-like
CDDcd001671.09E-8111156No hitNo description
PfamPF002498.6E-11111155IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MTRRCSHCSN NGHNSRTCPS SRGAAAGVKL FGVRLTDGSI IKKSASMGNL NLASSAHHHS  60
SPSSSNLAAS SPNPTSPCSD LLHEPHGYLS DDPAHISTLA NRRGERKKGV AWTEEEHRLF  120
LIGLQKLGKG DWRGIARNFV VSRTPTQVAS HAQKYFIRQS HATRRKRRSS LFDMVPDMTS  180
DPPSVPEEQV LLPPSEKPQP CNGKLQPSLN LSLKSEFEPM ETTSQENMDQ ANETMMGSNG  240
LTSMAPHGFF PTYLPVPYPI WPSTAAPFEE VKGGETSHHQ VHRPIPVIPK EPVNVDELVG  300
MSHLSIGETQ VRDREPSPLS LNLLGEPSRQ SAFHANAPVG GTDLKTGKNK AIQAV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150400.0AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007150607.10.0hypothetical protein PHAVU_005G166300g
RefseqXP_007150608.10.0hypothetical protein PHAVU_005G166300g
TrEMBLV7BX570.0V7BX57_PHAVU; Uncharacterized protein
STRINGGLYMA13G43120.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77193346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.11e-104MYB_related family protein